Lineage for d3th2t1 (3th2 T:6-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521340Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1521341Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
    Uniprot P13726 33-242
  8. 1521342Domain d3th2t1: 3th2 T:6-106 [200819]
    Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l2, d3th2l3
    automated match to d1uj3c1
    complexed with ben, bgc, ca, cl, fuc, mg, na

Details for d3th2t1

PDB Entry: 3th2 (more details), 1.72 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d3th2t1:

Sequence, based on SEQRES records: (download)

>d3th2t1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d3th2t1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpylet

SCOPe Domain Coordinates for d3th2t1:

Click to download the PDB-style file with coordinates for d3th2t1.
(The format of our PDB-style files is described here.)

Timeline for d3th2t1: