Lineage for d3tgxh_ (3tgx H:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266371Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1266372Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1266458Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1266533Protein Interleukin-21 (IL-21) [158425] (1 species)
  7. 1266534Species Human (Homo sapiens) [TaxId:9606] [158426] (2 PDB entries)
    Uniprot Q9HBE4 23-155
  8. 1266538Domain d3tgxh_: 3tgx H: [200816]
    automated match to d2oqpa1
    complexed with ful, man, ni, so4

Details for d3tgxh_

PDB Entry: 3tgx (more details), 2.8 Å

PDB Description: il-21:il21r complex
PDB Compounds: (H:) Interleukin-21

SCOPe Domain Sequences for d3tgxh_:

Sequence, based on SEQRES records: (download)

>d3tgxh_ a.26.1.2 (H:) Interleukin-21 (IL-21) {Human (Homo sapiens) [TaxId: 9606]}
drhmirmrqlidivdqlknyvndlvpeflpapedvetncewsafscfqkaqlksantgnn
eriinvsikklkrkppstnagrrqkhrltcpscdsyekkppkeflerfksllqkmihqhl

Sequence, based on observed residues (ATOM records): (download)

>d3tgxh_ a.26.1.2 (H:) Interleukin-21 (IL-21) {Human (Homo sapiens) [TaxId: 9606]}
drhmirmrqlidivdqlknyvndlvpeflpapedvetncewsafscfqkaqlksantgnn
eriinvsikklkrkppstnqkhrltcpscdsyekkppkeflerfksllqkmihqhl

SCOPe Domain Coordinates for d3tgxh_:

Click to download the PDB-style file with coordinates for d3tgxh_.
(The format of our PDB-style files is described here.)

Timeline for d3tgxh_: