Lineage for d3tgvb1 (3tgv B:13-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794448Species Vibrio cholerae [TaxId:345073] [193560] (1 PDB entry)
  8. 2794450Domain d3tgvb1: 3tgv B:13-150 [200811]
    Other proteins in same PDB: d3tgva2, d3tgva3, d3tgvb2, d3tgvb3, d3tgvc2, d3tgvc3, d3tgvd2, d3tgvd3
    automated match to d3tgvd_
    complexed with bez

Details for d3tgvb1

PDB Entry: 3tgv (more details), 2 Å

PDB Description: Crystal structure of HutZ,the heme storsge protein from Vibrio cholerae
PDB Compounds: (B:) Heme-binding protein HutZ

SCOPe Domain Sequences for d3tgvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgvb1 b.45.1.0 (B:13-150) automated matches {Vibrio cholerae [TaxId: 345073]}
rlepeikefrqerktlqlatvdaqgrpnvsyapfvqnqegyfvlishiarharnlevnpq
vsimmiedeteakqlfarkrltfdavasmverdselwcqviaqmgerfgeiidglsqlqd
fmlfrlqpeqglfvkgfg

SCOPe Domain Coordinates for d3tgvb1:

Click to download the PDB-style file with coordinates for d3tgvb1.
(The format of our PDB-style files is described here.)

Timeline for d3tgvb1: