Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Vibrio cholerae [TaxId:345073] [193560] (1 PDB entry) |
Domain d3tgvb1: 3tgv B:13-150 [200811] Other proteins in same PDB: d3tgva2, d3tgva3, d3tgvb2, d3tgvb3, d3tgvc2, d3tgvc3, d3tgvd2, d3tgvd3 automated match to d3tgvd_ complexed with bez |
PDB Entry: 3tgv (more details), 2 Å
SCOPe Domain Sequences for d3tgvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tgvb1 b.45.1.0 (B:13-150) automated matches {Vibrio cholerae [TaxId: 345073]} rlepeikefrqerktlqlatvdaqgrpnvsyapfvqnqegyfvlishiarharnlevnpq vsimmiedeteakqlfarkrltfdavasmverdselwcqviaqmgerfgeiidglsqlqd fmlfrlqpeqglfvkgfg
Timeline for d3tgvb1: