SCOPe 2.08: Domain d3tf6b_: 3tf6 B:

Lineage for d3tf6b_ (3tf6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)

8. Domain d3tf6b_: 3tf6 B: [200809]
   automated match to d3tf6c_
   complexed with cl, dbh, eu, gol, so4; mutant

Details for d3tf6b_

PDB Entry: 3tf6, 2.35 Å

PDB Description: crystal structure of neutrophil gelatinase-associated lipocalin (c87s mutant) in complex with europium and the siderophore analog tren(cam)(1,2-hopo)2

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3tf6b_:

Sequence, based on SEQRES records:

>d3tf6b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d3tf6b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredpqkmyatiyelkedksynv
tsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkv
sqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d3tf6b_:

• d3tf6b_ first appeared in SCOPe 2.03
  
• d3tf6b_ appears in SCOPe 2.07