Lineage for d3teol_ (3teo L:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372129Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1372172Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1372278Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 1372279Protein automated matches [190830] (3 species)
    not a true protein
  7. 1372280Species Acidianus sp. [TaxId:1071056] [193625] (2 PDB entries)
  8. 1372292Domain d3teol_: 3teo L: [200805]
    automated match to d3teoo_
    complexed with cl, pe3

Details for d3teol_

PDB Entry: 3teo (more details), 2.4 Å

PDB Description: apo form of carbon disulfide hydrolase (selenomethionine form)
PDB Compounds: (L:) Carbon disulfide hydrolase

SCOPe Domain Sequences for d3teol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3teol_ c.53.2.0 (L:) automated matches {Acidianus sp. [TaxId: 1071056]}
vseyidselkrledyalrrvkgipnnrrlwvltcmdervhieqslgiqpddahiyrnagg
ivtddairsaslttnffgtkeiivvthtdcgmlrftgeevakyfiskgikptevqldpll
pafrisseedfikwfkfyedlgvkspdemalkgveilrnhplipkdvritgyvyevethr
lrkpnqiiynetskfehgtivk

SCOPe Domain Coordinates for d3teol_:

Click to download the PDB-style file with coordinates for d3teol_.
(The format of our PDB-style files is described here.)

Timeline for d3teol_: