| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) ![]() |
| Family c.53.2.0: automated matches [191506] (1 protein) not a true family |
| Protein automated matches [190830] (15 species) not a true protein |
| Species Acidianus sp. [TaxId:1071056] [193625] (2 PDB entries) |
| Domain d3teog_: 3teo G: [200800] automated match to d3teoo_ complexed with cl, pe3 |
PDB Entry: 3teo (more details), 2.4 Å
SCOPe Domain Sequences for d3teog_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3teog_ c.53.2.0 (G:) automated matches {Acidianus sp. [TaxId: 1071056]}
vseyidselkrledyalrrvkgipnnrrlwvltcmdervhieqslgiqpddahiyrnagg
ivtddairsaslttnffgtkeiivvthtdcgmlrftgeevakyfiskgikptevqldpll
pafrisseedfikwfkfyedlgvkspdemalkgveilrnhplipkdvritgyvyevethr
lrkpnqiiynetskfehgtivk
Timeline for d3teog_: