Lineage for d1plgl1 (1plg L:1-112)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547441Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 547538Domain d1plgl1: 1plg L:1-112 [20080]
    Other proteins in same PDB: d1plgh1, d1plgh2, d1plgl2
    part of a polysialic acid-binding Fab

Details for d1plgl1

PDB Entry: 1plg (more details), 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plgl1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylywylqkpgqspkpliyrvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcfqgthvpytfgggtrleik

SCOP Domain Coordinates for d1plgl1:

Click to download the PDB-style file with coordinates for d1plgl1.
(The format of our PDB-style files is described here.)

Timeline for d1plgl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plgl2