SCOP 1.65: Domain d1plgl1: 1plg L:1-112

Lineage for d1plgl1 (1plg L:1-112)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d1plgl1: 1plg L:1-112 [20080]
   Other proteins in same PDB: d1plgh1, d1plgh2, d1plgl2
   part of a polysialic acid-binding Fab

Details for d1plgl1

PDB Entry: 1plg, 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl1:

Sequence; same for both SEQRES and ATOM records:

>d1plgl1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylywylqkpgqspkpliyrvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcfqgthvpytfgggtrleik

Timeline for d1plgl1:

• d1plgl1 first appeared (with stable ids) in SCOP 1.55
  
• d1plgl1 appears in SCOP 1.63
  
• d1plgl1 appears in SCOP 1.67
  
• d1plgl1 appears in the current release, SCOPe 2.08