Lineage for d1plgl1 (1plg L:1-112)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8024Species Polysialic acid-binding Fab (mouse), kappa L chain [48809] (1 PDB entry)
  8. 8026Domain d1plgl1: 1plg L:1-112 [20080]
    Other proteins in same PDB: d1plgh2, d1plgl2

Details for d1plgl1

PDB Entry: 1plg (more details), 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plgl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylywylqkpgqspkpliyrvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcfqgthvpytfgggtrleik

SCOP Domain Coordinates for d1plgl1:

Click to download the PDB-style file with coordinates for d1plgl1.
(The format of our PDB-style files is described here.)

Timeline for d1plgl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plgl2