SCOPe 2.08: Domain d3taua_: 3tau A:

Lineage for d3taua_ (3tau A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [196210] (1 PDB entry)

8. Domain d3taua_: 3tau A: [200792]
   automated match to d3taub_
   complexed with na, so4

Details for d3taua_

PDB Entry: 3tau, 2.05 Å

PDB Description: Crystal Structure of a Putative Guanylate Monophosphaste Kinase from Listeria monocytogenes EGD-e

PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d3taua_:

Sequence, based on SEQRES records:

>d3taua_ c.37.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}
tergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrev
feqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegifi
fltppdlselknriigrgtesmevveermetakkeiemmasydyavvndvvanavqkikg
ivetehlktervihrykkml

Sequence, based on observed residues (ATOM records):

>d3taua_ c.37.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}
tergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrev
feqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegifi
fltppdlselknrsmevveermetakkeiemmasydyavvndvvanavqkikgivetehl
ktervihrykkml

Timeline for d3taua_:

• d3taua_ first appeared in SCOPe 2.03
  
• d3taua_ appears in SCOPe 2.07