![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
![]() | Domain d3ta3c2: 3ta3 C:118-206 [200786] Other proteins in same PDB: d3ta3a1, d3ta3b_, d3ta3c1, d3ta3d1 automated match to d1qrnd2 complexed with 3tf, nag |
PDB Entry: 3ta3 (more details), 2.7 Å
SCOPe Domain Sequences for d3ta3c2:
Sequence, based on SEQRES records: (download)
>d3ta3c2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d3ta3c2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnkdfacanafnnsiipedtffps
Timeline for d3ta3c2: