Lineage for d3ta3c2 (3ta3 C:118-206)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2025695Domain d3ta3c2: 3ta3 C:118-206 [200786]
    Other proteins in same PDB: d3ta3a1, d3ta3b_, d3ta3c1, d3ta3d1
    automated match to d1qrnd2
    complexed with 3tf, nag

Details for d3ta3c2

PDB Entry: 3ta3 (more details), 2.7 Å

PDB Description: Structure of the mouse CD1d-Glc-DAG-s2-iNKT TCR complex
PDB Compounds: (C:) Valpha14 chimera (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3ta3c2:

Sequence, based on SEQRES records: (download)

>d3ta3c2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3ta3c2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3ta3c2:

Click to download the PDB-style file with coordinates for d3ta3c2.
(The format of our PDB-style files is described here.)

Timeline for d3ta3c2: