SCOPe 2.08: Domain d3ta3c2: 3ta3 C:118-206

Lineage for d3ta3c2 (3ta3 C:118-206)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3ta3c2: 3ta3 C:118-206 [200786]
   Other proteins in same PDB: d3ta3a1, d3ta3b_, d3ta3c1, d3ta3d1
   automated match to d1qrnd2
   complexed with 3tf, nag

Details for d3ta3c2

PDB Entry: 3ta3, 2.7 Å

PDB Description: structure of the mouse cd1d-glc-dag-s2-inkt tcr complex

PDB Compounds: (C:) Valpha14 chimera (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3ta3c2:

Sequence, based on SEQRES records:

>d3ta3c2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3ta3c2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

Timeline for d3ta3c2:

• d3ta3c2 first appeared in SCOPe 2.03
  
• d3ta3c2 appears in SCOPe 2.07