![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries) |
![]() | Domain d3ta3a1: 3ta3 A:7-185 [200783] Other proteins in same PDB: d3ta3a2, d3ta3b_, d3ta3c1, d3ta3c2, d3ta3d1, d3ta3d2 automated match to d1onqa2 complexed with 3tf, nag |
PDB Entry: 3ta3 (more details), 2.7 Å
SCOPe Domain Sequences for d3ta3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ta3a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3ta3a1: