Lineage for d3t94d_ (3t94 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888767Species Sulfolobus solfataricus [TaxId:2287] [187383] (2 PDB entries)
  8. 2888771Domain d3t94d_: 3t94 D: [200780]
    automated match to d2a8ya_
    complexed with mta, so4

Details for d3t94d_

PDB Entry: 3t94 (more details), 1.45 Å

PDB Description: Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP) II complexed with 5'-deoxy-5'-methylthioadenosine and sulfate
PDB Compounds: (D:) 5'-methylthioadenosine phosphorylase (mtaP)

SCOPe Domain Sequences for d3t94d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t94d_ c.56.2.1 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mieqnekasigiiggsglydpgifseskeikvytpygqpsdfitigkignksvaflprhg
rghripphkinyraniwalkelgvrwvisvsavgslrmdyklgdfvipdqfidmtknrey
sffdgpvvahvsmadpfcnslrklaietakelnikthesgtyiciegprfstraesrtwr
evykadiigmtlvpevnlaceaqmcyatiamvtdydvfaeipvtaeevtrvmaentekak
kllyaliqklpekpeegscsccnslktalv

SCOPe Domain Coordinates for d3t94d_:

Click to download the PDB-style file with coordinates for d3t94d_.
(The format of our PDB-style files is described here.)

Timeline for d3t94d_: