Lineage for d1aifl1 (1aif L:1-109)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7420Species Fab 409.5.3 (mouse), kappa L chain [48808] (2 PDB entries)
  8. 7426Domain d1aifl1: 1aif L:1-109 [20078]
    Other proteins in same PDB: d1aifa2, d1aifb2, d1aifh2, d1aifl2

Details for d1aifl1

PDB Entry: 1aif (more details), 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse

SCOP Domain Sequences for d1aifl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aifl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikr

SCOP Domain Coordinates for d1aifl1:

Click to download the PDB-style file with coordinates for d1aifl1.
(The format of our PDB-style files is described here.)

Timeline for d1aifl1: