SCOPe 2.05: Domain d3t8xc1: 3t8x C:6-183

Lineage for d3t8xc1 (3t8x C:6-183)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (10 PDB entries)

8. Domain d3t8xc1: 3t8x C:6-183 [200776]
   Other proteins in same PDB: d3t8xa2, d3t8xb_, d3t8xc2, d3t8xd_
   automated match to d1gzpa2
   complexed with act, gol, so4, t8x, uli

Details for d3t8xc1

PDB Entry: 3t8x, 1.9 Å

PDB Description: crystal structure of human cd1b in complex with synthetic antigenic diacylsulfoglycolipid sgl12 and endogenous spacer

PDB Compounds: (C:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d3t8xc1:

Sequence; same for both SEQRES and ATOM records:

>d3t8xc1 d.19.1.1 (C:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
gptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkevae
leeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldfls
vknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

Timeline for d3t8xc1:

• d3t8xc1 first appeared in SCOPe 2.03
  
• d3t8xc1 appears in SCOPe 2.04
  
• d3t8xc1 appears in SCOPe 2.06
  
• d3t8xc1 appears in the current release, SCOPe 2.08