| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein CD1, alpha-3 domain [88615] (5 species) |
| Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries) |
| Domain d3t8xa2: 3t8x A:184-278 [200775] Other proteins in same PDB: d3t8xa1, d3t8xb_, d3t8xc1, d3t8xc3, d3t8xd_ automated match to d1gzqa1 complexed with act, gol, so4, t8x, uli |
PDB Entry: 3t8x (more details), 1.9 Å
SCOPe Domain Sequences for d3t8xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t8xa2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr
Timeline for d3t8xa2: