Lineage for d3t8xa2 (3t8x A:184-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746777Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2746792Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries)
  8. 2746794Domain d3t8xa2: 3t8x A:184-278 [200775]
    Other proteins in same PDB: d3t8xa1, d3t8xb_, d3t8xc1, d3t8xc3, d3t8xd_
    automated match to d1gzqa1
    complexed with act, gol, so4, t8x, uli

Details for d3t8xa2

PDB Entry: 3t8x (more details), 1.9 Å

PDB Description: crystal structure of human cd1b in complex with synthetic antigenic diacylsulfoglycolipid sgl12 and endogenous spacer
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d3t8xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t8xa2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr

SCOPe Domain Coordinates for d3t8xa2:

Click to download the PDB-style file with coordinates for d3t8xa2.
(The format of our PDB-style files is described here.)

Timeline for d3t8xa2: