SCOPe 2.08: Domain d3t8xa2: 3t8x A:184-278

Lineage for d3t8xa2 (3t8x A:184-278)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries)

8. Domain d3t8xa2: 3t8x A:184-278 [200775]
   Other proteins in same PDB: d3t8xa1, d3t8xb_, d3t8xc1, d3t8xc3, d3t8xd_
   automated match to d1gzqa1
   complexed with act, gol, so4, t8x, uli

Details for d3t8xa2

PDB Entry: 3t8x, 1.9 Å

PDB Description: crystal structure of human cd1b in complex with synthetic antigenic diacylsulfoglycolipid sgl12 and endogenous spacer

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d3t8xa2:

Sequence; same for both SEQRES and ATOM records:

>d3t8xa2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr

Timeline for d3t8xa2:

• d3t8xa2 first appeared in SCOPe 2.03
  
• d3t8xa2 appears in SCOPe 2.07