![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
![]() | Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (10 PDB entries) |
![]() | Domain d3t8xa1: 3t8x A:4-183 [200774] Other proteins in same PDB: d3t8xa2, d3t8xb_, d3t8xc2, d3t8xc3, d3t8xd_ automated match to d1gzpa2 complexed with act, gol, so4, t8x, uli |
PDB Entry: 3t8x (more details), 1.9 Å
SCOPe Domain Sequences for d3t8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t8xa1 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr
Timeline for d3t8xa1: