Lineage for d3t89b_ (3t89 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100134Species Escherichia coli [TaxId:562] [196212] (2 PDB entries)
  8. 2100142Domain d3t89b_: 3t89 B: [200770]
    automated match to d3t89f_
    complexed with gol, mli

Details for d3t89b_

PDB Entry: 3t89 (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli menb, the 1,4-dihydroxy-2- naphthoyl-coa synthase in vitamin k2 biosynthesis
PDB Compounds: (B:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d3t89b_:

Sequence, based on SEQRES records: (download)

>d3t89b_ c.14.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
ryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvv
amvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkarei
wflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgq
aglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp

Sequence, based on observed residues (ATOM records): (download)

>d3t89b_ c.14.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
ryddnigviiltgagdkafcsggdqkvlnvldfqrqirtcpkpvvamvagysiggghvlh
mmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldm
glvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfy
mteegqegrnafqpdfskfkrnp

SCOPe Domain Coordinates for d3t89b_:

Click to download the PDB-style file with coordinates for d3t89b_.
(The format of our PDB-style files is described here.)

Timeline for d3t89b_: