Lineage for d1aifb1 (1aif B:1-121)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755910Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (63 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1755992Domain d1aifb1: 1aif B:1-121 [20077]
    Other proteins in same PDB: d1aifa1, d1aifa2, d1aifb2, d1aifh2, d1aifl1, d1aifl2
    part of Fab 409.5.3

Details for d1aifb1

PDB Entry: 1aif (more details), 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse
PDB Compounds: (B:) anti-idiotypic fab 409.5.3 (igg2a) fab (heavy chain)

SCOPe Domain Sequences for d1aifb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aifb1 b.1.1.1 (B:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
s

SCOPe Domain Coordinates for d1aifb1:

Click to download the PDB-style file with coordinates for d1aifb1.
(The format of our PDB-style files is described here.)

Timeline for d1aifb1: