| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab 409.5.3 (mouse), kappa L chain [48808] (2 PDB entries) |
| Domain d1aifb1: 1aif B:1-121 [20077] Other proteins in same PDB: d1aifa2, d1aifb2, d1aifh2, d1aifl2 |
PDB Entry: 1aif (more details), 2.9 Å
SCOP Domain Sequences for d1aifb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aifb1 b.1.1.1 (B:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
s
Timeline for d1aifb1: