Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
Protein automated matches [190527] (4 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [196169] (1 PDB entry) |
Domain d3t7ba_: 3t7b A: [200768] automated match to d3t7bb_ complexed with glu, srt |
PDB Entry: 3t7b (more details), 2.5 Å
SCOPe Domain Sequences for d3t7ba_:
Sequence, based on SEQRES records: (download)
>d3t7ba_ c.73.1.2 (A:) automated matches {Yersinia pestis [TaxId: 214092]} amnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvv kknglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelg hvgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlills dvsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhs eqlpalfngvpigtrisv
>d3t7ba_ c.73.1.2 (A:) automated matches {Yersinia pestis [TaxId: 214092]} amnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvv kknglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelg hvgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlills dvsgildqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhseql palfngvpigtrisv
Timeline for d3t7ba_: