Lineage for d3t6eh1 (3t6e H:1-36)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630999Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2631000Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2631001Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2631100Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
    synonym: blastochloris viridis
  8. 2631101Domain d3t6eh1: 3t6e H:1-36 [200766]
    Other proteins in same PDB: d3t6ec_, d3t6eh2, d3t6el_, d3t6em_
    automated match to d6prch2
    complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6eh1

PDB Entry: 3t6e (more details), 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3t6eh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6eh1 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d3t6eh1:

Click to download the PDB-style file with coordinates for d3t6eh1.
(The format of our PDB-style files is described here.)

Timeline for d3t6eh1: