Lineage for d3t6ec_ (3t6e C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339824Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2339825Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2339933Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2339934Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 2339935Species Rhodopseudomonas viridis [TaxId:1079] [48709] (21 PDB entries)
  8. 2339936Domain d3t6ec_: 3t6e C: [200765]
    Other proteins in same PDB: d3t6eh1, d3t6eh2, d3t6el_, d3t6em_
    automated match to d2jblc_
    complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6ec_

PDB Entry: 3t6e (more details), 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3t6ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6ec_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpikaa

SCOPe Domain Coordinates for d3t6ec_:

Click to download the PDB-style file with coordinates for d3t6ec_.
(The format of our PDB-style files is described here.)

Timeline for d3t6ec_: