SCOPe 2.08: Domain d3t6ec_: 3t6e C:

Lineage for d3t6ec_ (3t6e C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)

8. Domain d3t6ec_: 3t6e C: [200765]
   Other proteins in same PDB: d3t6eh1, d3t6eh2, d3t6el_, d3t6em_
   automated match to d2jblc_
   complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6ec_

PDB Entry: 3t6e, 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3t6ec_:

Sequence; same for both SEQRES and ATOM records:

>d3t6ec_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpikaa

Timeline for d3t6ec_:

• d3t6ec_ first appeared in SCOPe 2.03
  
• d3t6ec_ appears in SCOPe 2.07