SCOPe 2.08: Domain d3t6dc_: 3t6d C:

Lineage for d3t6dc_ (3t6d C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein automated matches [227073] (3 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [226253] (2 PDB entries)

8. Domain d3t6dc_: 3t6d C: [200764]
   Other proteins in same PDB: d3t6dh1, d3t6dh2, d3t6dl_, d3t6dm_
   automated match to d1prcc_
   complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dc_

PDB Entry: 3t6d, 1.95 Å

PDB Description: crystal structure of the reaction centre from blastochloris viridis strain dsm 133 (atcc 19567) substrain-08

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3t6dc_:

Sequence; same for both SEQRES and ATOM records:

>d3t6dc_ a.138.1.2 (C:) automated matches {Blastochloris viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalpavkaegppvsqvyknvk
vlgnlteaeflrtmtamtewvspeegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqsfetwgkkstpqraiawwgirmvrdmnmnylaplntvlpasrlgrqgea
pqadcrtchqgvtkplfgasrlqdypelgpikaa

Timeline for d3t6dc_:

• d3t6dc_ first appeared in SCOPe 2.03
  
• d3t6dc_ appears in SCOPe 2.07