| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
| Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries) |
| Domain d3t67b_: 3t67 B: [200762] Other proteins in same PDB: d3t67m_, d3t67n_, d3t67o_ automated match to d3pcca_ complexed with caq, fe, gol, so4; mutant |
PDB Entry: 3t67 (more details), 1.67 Å
SCOPe Domain Sequences for d3t67b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t67b_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf
Timeline for d3t67b_: