Lineage for d3t52f_ (3t52 F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151524Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2151561Protein automated matches [190860] (3 species)
    not a true protein
  7. 2151566Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries)
  8. 2151584Domain d3t52f_: 3t52 F: [200758]
    automated match to d3t52b_
    complexed with act, cl, gol, peo, so4; mutant

Details for d3t52f_

PDB Entry: 3t52 (more details), 2 Å

PDB Description: L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
PDB Compounds: (F:) Arylesterase

SCOPe Domain Sequences for d3t52f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t52f_ c.69.1.12 (F:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwildadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr

SCOPe Domain Coordinates for d3t52f_:

Click to download the PDB-style file with coordinates for d3t52f_.
(The format of our PDB-style files is described here.)

Timeline for d3t52f_: