| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.12: Haloperoxidase [53531] (8 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
| Protein automated matches [190860] (3 species) not a true protein |
| Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries) |
| Domain d3t52c_: 3t52 C: [200756] automated match to d3t52b_ complexed with act, cl, gol, peo, so4; mutant |
PDB Entry: 3t52 (more details), 2 Å
SCOPe Domain Sequences for d3t52c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t52c_ c.69.1.12 (C:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwildadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr
Timeline for d3t52c_: