SCOPe 2.07: Domain d3t3pl2: 3t3p L:108-214

Lineage for d3t3pl2 (3t3p L:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3t3pl2: 3t3p L:108-214 [200750]
   Other proteins in same PDB: d3t3pa_, d3t3pc_, d3t3pf1, d3t3pl1
   automated match to d1dqdl2
   complexed with bma, ca, cl, gol, man, mg, nag, so4

Details for d3t3pl2

PDB Entry: 3t3p, 2.2 Å

PDB Description: a novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3t3pl2:

Sequence; same for both SEQRES and ATOM records:

>d3t3pl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3t3pl2:

• d3t3pl2 first appeared in SCOPe 2.03
  
• d3t3pl2 appears in SCOPe 2.06
  
• d3t3pl2 appears in the current release, SCOPe 2.08