Class b: All beta proteins [48724] (177 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (8 species) not a true protein |
Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries) |
Domain d3szif_: 3szi F: [200737] Other proteins in same PDB: d3szid2, d3szig2, d3szij2 automated match to d3szia_ complexed with fmt |
PDB Entry: 3szi (more details), 1.4 Å
SCOPe Domain Sequences for d3szif_:
Sequence, based on SEQRES records: (download)
>d3szif_ b.61.1.0 (F:) automated matches {Shewanella denitrificans [TaxId: 318161]} qeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfs tkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqtsa
>d3szif_ b.61.1.0 (F:) automated matches {Shewanella denitrificans [TaxId: 318161]} qeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfs tkwlnsvescnsitswsgfyintgqgkistlwqlvvngssspsqilkgqdvfsqtsa
Timeline for d3szif_: