Lineage for d3szie_ (3szi E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073773Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2073774Protein automated matches [190537] (8 species)
    not a true protein
  7. 2073811Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 2073826Domain d3szie_: 3szi E: [200736]
    Other proteins in same PDB: d3szid2, d3szig2, d3szij2
    automated match to d3szig_
    complexed with fmt

Details for d3szie_

PDB Entry: 3szi (more details), 1.4 Å

PDB Description: Structure of apo shwanavidin (P21 form)
PDB Compounds: (E:) Avidin/streptavidin

SCOPe Domain Sequences for d3szie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szie_ b.61.1.0 (E:) automated matches {Shewanella denitrificans [TaxId: 318161]}
aqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts

SCOPe Domain Coordinates for d3szie_:

Click to download the PDB-style file with coordinates for d3szie_.
(The format of our PDB-style files is described here.)

Timeline for d3szie_: