Lineage for d3sxte_ (3sxt E:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964111Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1964112Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1964113Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1964136Protein automated matches [190303] (3 species)
    not a true protein
  7. 1964169Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1964175Domain d3sxte_: 3sxt E: [200733]
    Other proteins in same PDB: d3sxtd_, d3sxtf_
    automated match to d3sxtc_
    complexed with ca, edo, hec, na

Details for d3sxte_

PDB Entry: 3sxt (more details), 1.81 Å

PDB Description: Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3sxte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxte_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklatasxvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3sxte_:

Click to download the PDB-style file with coordinates for d3sxte_.
(The format of our PDB-style files is described here.)

Timeline for d3sxte_: