Lineage for d3sxte_ (3sxt E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034454Protein Methylamine dehydrogenase [57563] (2 species)
  7. 3034455Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 3034459Domain d3sxte_: 3sxt E: [200733]
    Other proteins in same PDB: d3sxtd_, d3sxtf_
    automated match to d3sxtc_
    complexed with ca, edo, hec, na

Details for d3sxte_

PDB Entry: 3sxt (more details), 1.81 Å

PDB Description: Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3sxte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxte_ g.21.1.1 (E:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklatasxvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3sxte_:

Click to download the PDB-style file with coordinates for d3sxte_.
(The format of our PDB-style files is described here.)

Timeline for d3sxte_: