| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab 730.1.4 (mouse), kappa L chain [48807] (1 PDB entry) |
| Domain d1iaih1: 1iai H:1-121 [20073] Other proteins in same PDB: d1iaih2, d1iaii2, d1iail2, d1iaim2 |
PDB Entry: 1iai (more details), 2.9 Å
SCOP Domain Sequences for d1iaih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaih1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 730.1.4 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmawintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcardgyyenyyamdywgqgtsvtvs
s
Timeline for d1iaih1: