Lineage for d3swta_ (3swt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2071269Species Mycobacterium marinum [TaxId:216594] [196268] (1 PDB entry)
  8. 2071270Domain d3swta_: 3swt A: [200723]
    automated match to d3swtb_
    complexed with edo, fe, peg

Details for d3swta_

PDB Entry: 3swt (more details), 2.05 Å

PDB Description: crystal structure of the taurine catabolism dioxygenase, taud from mycobacterium marinum
PDB Compounds: (A:) Taurine catabolism dioxygenase, TauD

SCOPe Domain Sequences for d3swta_:

Sequence, based on SEQRES records: (download)

>d3swta_ b.82.2.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
litvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddqqqlqfag
llgtpighpaaaaalpdapiitpinsewgkanrwhtdvtfaanypaasilravtlpnygg
stlwantatayaelpeplkclvenlwalhtnrydyvaneavqaltdtqqafrqafqkpdf
rtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrritspentirwnwesg
dvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisgaplal

Sequence, based on observed residues (ATOM records): (download)

>d3swta_ b.82.2.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
litvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddqqqlqfag
llgtpianrwhtdvtfaanypaasilravtlpnyggstlwantatayaelpeplkclven
lwalhtnrpdfrtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrritsp
entirwnwesgdvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisga
plal

SCOPe Domain Coordinates for d3swta_:

Click to download the PDB-style file with coordinates for d3swta_.
(The format of our PDB-style files is described here.)

Timeline for d3swta_: