Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) |
Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins) duplication: 6 repeats of this fold are organized in two RPTC-like domains automatically mapped to Pfam PF00275 |
Protein automated matches [190917] (9 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188769] (8 PDB entries) |
Domain d3swdg_: 3swd G: [200722] automated match to d3swdk_ complexed with epz |
PDB Entry: 3swd (more details), 2.5 Å
SCOPe Domain Sequences for d3swdg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3swdg_ d.68.2.2 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql gakverdgsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggxtigar pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg
Timeline for d3swdg_: