SCOP 1.63: Domain d1iail1: 1iai L:1-108

Lineage for d1iail1 (1iai L:1-108)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 730.1.4 (mouse), kappa L chain [48807] (1 PDB entry)

8. Domain d1iail1: 1iai L:1-108 [20072]
   Other proteins in same PDB: d1iaih2, d1iaii2, d1iail2, d1iaim2

Details for d1iail1

PDB Entry: 1iai, 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

SCOP Domain Sequences for d1iail1:

Sequence; same for both SEQRES and ATOM records:

>d1iail1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 730.1.4 (mouse), kappa L chain}
divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyqytgvpd
rftgsgsrtdftftinsvqaedlavyychqhystpftfgsgtkleikr

Timeline for d1iail1:

• d1iail1 first appeared (with stable ids) in SCOP 1.55
  
• d1iail1 appears in SCOP 1.61
  
• d1iail1 appears in SCOP 1.65
  
• d1iail1 appears in the current release, SCOPe 2.08