Lineage for d1iail1 (1iai L:1-108)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52146Species Fab 730.1.4 (mouse), kappa L chain [48807] (1 PDB entry)
  8. 52148Domain d1iail1: 1iai L:1-108 [20072]
    Other proteins in same PDB: d1iaih2, d1iaii2, d1iail2, d1iaim2

Details for d1iail1

PDB Entry: 1iai (more details), 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

SCOP Domain Sequences for d1iail1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iail1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 730.1.4 (mouse), kappa L chain}
divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyqytgvpd
rftgsgsrtdftftinsvqaedlavyychqhystpftfgsgtkleikr

SCOP Domain Coordinates for d1iail1:

Click to download the PDB-style file with coordinates for d1iail1.
(The format of our PDB-style files is described here.)

Timeline for d1iail1: