SCOPe 2.06: Domain d3sw5a_: 3sw5 A:

Lineage for d3sw5a_ (3sw5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.0: automated matches [191399] (1 protein)
   not a true family

6. Protein automated matches [190523] (11 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [196244] (1 PDB entry)

8. Domain d3sw5a_: 3sw5 A: [200712]
   automated match to d3sw5f_
   complexed with lmr

Details for d3sw5a_

PDB Entry: 3sw5, 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase from bartonella henselae

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3sw5a_:

Sequence; same for both SEQRES and ATOM records:

>d3sw5a_ b.40.5.0 (A:) automated matches {Bartonella henselae [TaxId: 38323]}
nikeiavgknppedvnvivevslggqpikyemdkksgalfvdrflytsmvypgnygfvph
tlsedgdpidvlicntrpllpgcvinvypigalimeddggkdekiiaiptpkltqrynni
hdytdlpeitlkqiehffehykdlepgkwakiegwrdksfahelikqaiernk

Timeline for d3sw5a_:

• d3sw5a_ first appeared in SCOPe 2.03
  
• d3sw5a_ appears in SCOPe 2.05
  
• d3sw5a_ appears in SCOPe 2.07
  
• d3sw5a_ appears in the current release, SCOPe 2.08