Lineage for d3svub_ (3svu B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2184788Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 2184818Domain d3svub_: 3svu B: [200710]
    automated match to d3svud_
    mutant

Details for d3svub_

PDB Entry: 3svu (more details), 2.69 Å

PDB Description: Crystal structure of mKate mutant S143C
PDB Compounds: (B:) mkate S143C

SCOPe Domain Sequences for d3svub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svub_ d.22.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
salitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats
fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
rgvnfpsngpvmqkktlgweactemlypadgglegrsdmalklvggghlicnlkttyrsk
kpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpsklahk

SCOPe Domain Coordinates for d3svub_:

Click to download the PDB-style file with coordinates for d3svub_.
(The format of our PDB-style files is described here.)

Timeline for d3svub_: