SCOPe 2.04: Domain d1nsnh1: 1nsn H:1-114

Lineage for d1nsnh1 (1nsn H:1-114)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (39 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d1nsnh1: 1nsn H:1-114 [20071]
   Other proteins in same PDB: d1nsnh2, d1nsnl1, d1nsnl2, d1nsns_
   part of Fab N10

Details for d1nsnh1

PDB Entry: 1nsn, 2.8 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

PDB Compounds: (H:) igg fab (igg1, kappa)

SCOPe Domain Sequences for d1nsnh1:

Sequence; same for both SEQRES and ATOM records:

>d1nsnh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgttsy
npslksrisisrdtsknqffmqlnsvttedtgtfyctrgngdwgqgttltvssa

Timeline for d1nsnh1:

• d1nsnh1 first appeared (with stable ids) in SCOP 1.55
  
• d1nsnh1 appears in SCOPe 2.03
  
• d1nsnh1 appears in SCOPe 2.05
  
• d1nsnh1 appears in the current release, SCOPe 2.08