Lineage for d3svoc_ (3svo C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2508715Protein automated matches [190406] (18 species)
    not a true protein
  7. 2508731Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 2508754Domain d3svoc_: 3svo C: [200708]
    automated match to d3svod_
    mutant

Details for d3svoc_

PDB Entry: 3svo (more details), 1.98 Å

PDB Description: Crystal structure of mKate mutant S158A/S143C at pH 10.0
PDB Compounds: (C:) mkate S158A/S143C

SCOPe Domain Sequences for d3svoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svoc_ d.22.1.1 (C:) automated matches {Artificial gene [TaxId: 32630]}
alitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnfpsngpvmqkktlgweactemlypadgglegradmalklvggghlicnlkttyrskk
paknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3svoc_:

Click to download the PDB-style file with coordinates for d3svoc_.
(The format of our PDB-style files is described here.)

Timeline for d3svoc_: