Lineage for d1nsnl1 (1nsn L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354130Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2354154Domain d1nsnl1: 1nsn L:1-107 [20070]
    Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl2, d1nsns_
    part of Fab N10

Details for d1nsnl1

PDB Entry: 1nsn (more details), 2.8 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
PDB Compounds: (L:) igg fab (igg1, kappa)

SCOPe Domain Sequences for d1nsnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsnl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspsslavslgqratiscrasqsvstssfrymhwyqqkpgqpprllikyasnles
gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleik

SCOPe Domain Coordinates for d1nsnl1:

Click to download the PDB-style file with coordinates for d1nsnl1.
(The format of our PDB-style files is described here.)

Timeline for d1nsnl1: