SCOPe 2.05: Domain d3spse_: 3sps E:

Lineage for d3spse_ (3sps E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Acyl-CoA hydrolase BH0798 [117883] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [117884] (2 PDB entries)
   Uniprot Q9KEQ1

8. Domain d3spse_: 3sps E: [200692]
   automated match to d1vpma_

Details for d3spse_

PDB Entry: 3sps, 2.9 Å

PDB Description: Crystal Structure of Apo-Hexameric Acyl-CoA Thioesterase

PDB Compounds: (E:) acyl-CoA hydrolase

SCOPe Domain Sequences for d3spse_:

Sequence; same for both SEQRES and ATOM records:

>d3spse_ d.38.1.1 (E:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}
iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
kpkpvpqvepqteeekrlyetaparkenrkkraalr

Timeline for d3spse_:

• d3spse_ first appeared in SCOPe 2.03
  
• d3spse_ appears in SCOPe 2.04
  
• d3spse_ appears in SCOPe 2.06
  
• d3spse_ appears in the current release, SCOPe 2.08