SCOPe 2.02: Domain d1opgh1: 1opg H:1-125

Lineage for d1opgh1 (1opg H:1-125)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (53 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1opgh1: 1opg H:1-125 [20069]
   Other proteins in same PDB: d1opgh2, d1opgl1, d1opgl2
   part of anti-integrin Fab OPG2

Details for d1opgh1

PDB Entry: 1opg, 2 Å

PDB Description: opg2 fab fragment

PDB Compounds: (H:) opg2 fab (heavy chain)

SCOPe Domain Sequences for d1opgh1:

Sequence; same for both SEQRES and ATOM records:

>d1opgh1 b.1.1.1 (H:1-125) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
vtvsa

Timeline for d1opgh1:

• d1opgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1opgh1 appears in SCOPe 2.01
  
• d1opgh1 appears in SCOPe 2.03
  
• d1opgh1 appears in the current release, SCOPe 2.08