SCOP 1.63: Domain d1opgh1: 1opg H:1-125

Lineage for d1opgh1 (1opg H:1-125)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-integrin Fab OPG2 (mouse), kappa L chain [48805] (2 PDB entries)

8. Domain d1opgh1: 1opg H:1-125 [20069]
   Other proteins in same PDB: d1opgh2, d1opgl2

Details for d1opgh1

PDB Entry: 1opg, 2 Å

PDB Description: opg2 fab fragment

SCOP Domain Sequences for d1opgh1:

Sequence; same for both SEQRES and ATOM records:

>d1opgh1 b.1.1.1 (H:1-125) Immunoglobulin (variable domains of L and H chains) {Anti-integrin Fab OPG2 (mouse), kappa L chain}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
vtvsa

Timeline for d1opgh1:

• d1opgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1opgh1 appears in SCOP 1.61
  
• d1opgh1 appears in SCOP 1.65
  
• d1opgh1 appears in the current release, SCOPe 2.08