SCOPe 2.05: Domain d3slbd_: 3slb D:

Lineage for d3slbd_ (3slb D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.0: automated matches [191555] (1 protein)
   not a true family

6. Protein automated matches [190957] (3 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries)

8. Domain d3slbd_: 3slb D: [200677]
   automated match to d3kzld_
   complexed with aco, cps, cyt, epe, mg

Details for d3slbd_

PDB Entry: 3slb, 2 Å

PDB Description: crystal structure of ba2930 in complex with accoa and cytosine

PDB Compounds: (D:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3slbd_:

Sequence; same for both SEQRES and ATOM records:

>d3slbd_ c.140.1.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
sntsvglsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
gkignakcrlmkqrdivdfgtewfrk

Timeline for d3slbd_:

• d3slbd_ first appeared in SCOPe 2.03
  
• d3slbd_ appears in SCOPe 2.04
  
• d3slbd_ is called d3slbd1 in SCOPe 2.06
  
• d3slbd_ appears in the current release, SCOPe 2.08, called d3slbd1