![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
![]() | Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) ![]() |
![]() | Family c.140.1.0: automated matches [191555] (1 protein) not a true family |
![]() | Protein automated matches [190957] (7 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries) |
![]() | Domain d3slbd1: 3slb D:1-263 [200677] Other proteins in same PDB: d3slba2, d3slbb2, d3slbc2, d3slbd2 automated match to d3kzld_ complexed with aco, cps, cyt, epe, mg |
PDB Entry: 3slb (more details), 2 Å
SCOPe Domain Sequences for d3slbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3slbd1 c.140.1.0 (D:1-263) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt svglsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki gnakcrlmkqrdivdfgtewfrk
Timeline for d3slbd1: