Lineage for d3slbd1 (3slb D:1-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923433Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2923434Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2923450Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2923451Protein automated matches [190957] (7 species)
    not a true protein
  7. 2923452Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries)
  8. 2923458Domain d3slbd1: 3slb D:1-263 [200677]
    Other proteins in same PDB: d3slba2, d3slbb2, d3slbc2, d3slbd2
    automated match to d3kzld_
    complexed with aco, cps, cyt, epe, mg

Details for d3slbd1

PDB Entry: 3slb (more details), 2 Å

PDB Description: crystal structure of ba2930 in complex with accoa and cytosine
PDB Compounds: (D:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3slbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slbd1 c.140.1.0 (D:1-263) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit
eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty
pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt
svglsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki
gnakcrlmkqrdivdfgtewfrk

SCOPe Domain Coordinates for d3slbd1:

Click to download the PDB-style file with coordinates for d3slbd1.
(The format of our PDB-style files is described here.)

Timeline for d3slbd1: