Lineage for d3sjua_ (3sju A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347798Protein automated matches [190085] (38 species)
    not a true protein
  7. 1348089Species Streptomyces griseoruber [TaxId:1943] [196180] (1 PDB entry)
  8. 1348090Domain d3sjua_: 3sju A: [200673]
    automated match to d3sjub_
    complexed with ndp

Details for d3sjua_

PDB Entry: 3sju (more details), 2.4 Å

PDB Description: hedamycin polyketide ketoreductase bound to nadph
PDB Compounds: (A:) Keto reductase

SCOPe Domain Sequences for d3sjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjua_ c.2.1.2 (A:) automated matches {Streptomyces griseoruber [TaxId: 1943]}
qtafvtgvssgiglavartlaargiavygcardaknvsaavdglraaghdvdgsscdvts
tdevhaavaaaverfgpigilvnsagrngggetadlddalwadvldtnltgvfrvtrevl
raggmreagwgrivniastggkqgvmyaapytaskhgvvgftksvgfelaktgitvnavc
pgyvetpmaervregyarhwgvteqevherfnakiplgrystpeevaglvgylvtdaaas
itaqalnvcgglgny

SCOPe Domain Coordinates for d3sjua_:

Click to download the PDB-style file with coordinates for d3sjua_.
(The format of our PDB-style files is described here.)

Timeline for d3sjua_: