SCOPe 2.06: Domain d3sirc_: 3sir C:

Lineage for d3sirc_ (3sir C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein automated matches [190398] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [196246] (1 PDB entry)

8. Domain d3sirc_: 3sir C: [200670]
   automated match to d3sird_

Details for d3sirc_

PDB Entry: 3sir, 2.68 Å

PDB Description: crystal structure of drice

PDB Compounds: (C:) Caspase

SCOPe Domain Sequences for d3sirc_:

Sequence, based on SEQRES records:

>d3sirc_ c.17.1.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaeynmrhknrgmalifnhehfevptlksragtnvdcenltrvlkqldfevtvykdcryk
dilrtieysasqnhsdsdcilvailshgemgyiyakdtqykldniwsfftanhcpslagk
pklffiqacqgdrldggvtmqrsqtetdgdssmsykipvhadfliaystvpgfyswrntt
rgswfmqslcaelaangkrldiltlltfvcqrvavdfesctpdtpemhqqkqipcittml
trilrfs

Sequence, based on observed residues (ATOM records):

>d3sirc_ c.17.1.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaeynmrhknrgmalifnhnvdcenltrvlkqldfevtvykdcrykdilrtieysasqnh
sdsdcilvailsniwsfftanhcpslagkpklffiqacqvhadfliaystvpswfmqslc
aelaangkrldiltlltfvcqrvavdqipcittmltrilrfs

Timeline for d3sirc_:

• d3sirc_ first appeared in SCOPe 2.03
  
• d3sirc_ appears in SCOPe 2.05
  
• d3sirc_ appears in SCOPe 2.07
  
• d3sirc_ appears in the current release, SCOPe 2.08